Solved

Parse individual characters into a Matrix in Matlab

Posted on 2014-10-03
1
156 Views
Last Modified: 2016-03-02
I need to parse a string of characters MTMSTNNCESMTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNPNQQGNMPYPRFPPYDRMPYYNGQGMDQQQQQH

for Each individual character into its own cell in a matrix.

As example first character goes in cell 1,1, second character goes into cell 1,2, third into 1,3 and so forth.

I need to do this using Mat Lab - also I am new to Mat Lab
0
Comment
Question by:gilnari
1 Comment
 
LVL 25

Accepted Solution

by:
nickg5 earned 500 total points
ID: 40361126
0

Featured Post

6 Surprising Benefits of Threat Intelligence

All sorts of threat intelligence is available on the web. Intelligence you can learn from, and use to anticipate and prepare for future attacks.

Join & Write a Comment

I previously wrote an article addressing the use of UBCD4WIN and SARDU. All are great, but I have always been an advocate of SARDU. Recently it was suggested that I go back and take a look at Easy2Boot in comparison.
Today companies are subjected to more-and-more data, and it won't stop any time soon.  But there are obvious opportunities for reducing data, particularly data duplicated among companies.
This video demonstrates how to use each tool, their shortcuts, where and when to use them, and how to use the keyboard to improve workflow.
Using Adobe Premiere Pro, the viewer will learn how to set up a sequence with proper settings, importing pictures, rendering, and exporting the finished product.

757 members asked questions and received personalized solutions in the past 7 days.

Join the community of 500,000 technology professionals and ask your questions.

Join & Ask a Question

Need Help in Real-Time?

Connect with top rated Experts

19 Experts available now in Live!

Get 1:1 Help Now